USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Kathryn- Modest Pull On Skirt
Kathryn- Modest Pull On Skirt Kathryn- Modest Pull On Skirt Kathryn- Modest Pull On Skirt Kathryn- Modest Pull On Skirt Kathryn- Modest Pull On Skirt

Kathryn- Modest Pull On Skirt

$30.00 inc. tax
A popular skirt style similar to the CLASSIC U-CUT "BULLET" SKIRT but with longer outseams for a more modest look.

Different colors may be requested at no extra cost - request
Product Code: 11120
Product Condition: New
Related Products
Simple Ballet Skirt
Simple Ballet Skirt
$25.00
Margot- The Shirt Skirt
Margot- The Shirt Skirt
$30.00
Classic U-Cut
Classic U-Cut "Bullet" ..
$30.00
Romantic Tutu
Romantic Tutu
$85.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i